PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G387900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 406aa    MW: 43332.1 Da    PI: 5.4521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G387900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-1896141147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg+W++eEd  l ++v++lG ++W++Iar ++ gR++k+c++rw + 
  Sevir.5G387900.1.p  96 RGPWSPEEDTVLSNLVEKLGARNWTLIARGIP-GRSGKSCRLRWCNQ 141
                         89******************************.***********985 PP

2Myb_DNA-binding51.22.8e-16148192147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r+++T+eEd +++ a++ +G++ W+ Ia+ +  gRt++ +k++w++ 
  Sevir.5G387900.1.p 148 RKPFTEEEDRIIIAAHAIHGNK-WACIAKLLD-GRTDNAIKNHWNST 192
                         789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.27191146IPR017930Myb domain
SuperFamilySSF466891.37E-3094189IPR009057Homeodomain-like
SMARTSM007171.1E-1495144IPR001005SANT/Myb domain
PfamPF002494.0E-1796141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2697149IPR009057Homeodomain-like
CDDcd001674.07E-1498140No hitNo description
PROSITE profilePS5129421.896147197IPR017930Myb domain
SMARTSM007174.7E-15147195IPR001005SANT/Myb domain
PfamPF002495.6E-14148192IPR001005SANT/Myb domain
CDDcd001671.20E-11150193No hitNo description
Gene3DG3DSA:1.10.10.602.1E-23150196IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MSAAPETAVS PAPQPEPPSD PPAVADAAHS NPPPMEVDTQ TLAEPQPQPQ PNPPSPPPSG  60
EDDDVVAVSG ASVGGDAADS AAASAAATAT AEERVRGPWS PEEDTVLSNL VEKLGARNWT  120
LIARGIPGRS GKSCRLRWCN QLDPQVKRKP FTEEEDRIII AAHAIHGNKW ACIAKLLDGR  180
TDNAIKNHWN STLRRRYCND GRCKHGGSVE RSTPEVSRAV SKEPWPSKDL SSFTAMDVRD  240
APVKTVPETS AGAWHVADQY YSTQAVDPPY LSRPAAKIGA FRPYNPGNAE PTQQETPSSV  300
FKFDSTLKAL TPESEVFKFA DPTYFAAEVP NKCGHGCCTA HGRPRKNSLL GPEFNEFEDH  360
PPILNSSFAS LVSEISSIAW MRSGMQSGDA SSLLQSAPPG ASLTN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-40951966107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970585.10.0PREDICTED: transcription factor MYB59-like
TrEMBLK3XIG40.0K3XIG4_SETIT; Uncharacterized protein
STRINGSi001686m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89903647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.12e-76myb domain protein 109